Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Abc2

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) Binds to the RecC subunit of RecBCD and promotes its recombination activity.
Evidence Co-purification (ECO_0000022) and electrophoresis showed binding to the RecBCD complex (DOI: 10.1016/S0021-9258(17)31676-9), and genetic interaction evidence (the overexpression of RecC suppresses the phenotype caused by Abc2, ECO_0000011) supports interaction with RecC.
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli RecBCD
Relevant publication(s) DOI 10.1006/jmbi.1999.3486
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Bacteriophage P22
Defence system(s) inhibited by the protein Defences RecBCD

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
Anti-RecBCD_p2 PF11043 97 1 97 1 97 1 97 1.3e-70

Sequence Viewer

Amino acid position: -

MPAPLYGADDPRRCSGNSVSEVLDKFRKNYDLIMSLPQETKEEKEFRHCIWLAEKEERERIYQTAIRPFRKATYTKFIEIDPRLRDYRSRYGAISNN