Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems

Protein: Aca2

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype None
Relevant publication(s) DOI 10.1038/nmicrobiol.2016.85
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 7EZY_A
Genome(s) encoding the protein Protein Source -
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 7EZY_A

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
DUF1870 PF08965 118 1 113 1 112 1 117 2.6e-28

Sequence Viewer

Amino acid position: -

MTHYELQALRKLLMLEVSEAAREIGDVSPRSWQYWESGRSPVPDDVANQIRNLTDMRYQLLELRTEQIEKAGKPIQLNFYRTLDDYEAVTGKRDVVSWRLTQAVAATLFAEGDVTLVEQGGLTLE