Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Acb1

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) serves as a metal-independent phosphodiesterase and hydrolyses the host's cyclic di- and trinucleotide CBASS signals, such as 3'3'-cGAMP, 3'3'-cUA and 3'3'3'-cAAA.
Evidence Cell lysates from E. coli infected with phage T4 degraded CBASS signals such as 3′3′-cGAMP, cUA, and cAAA. Purified T4 Acb1 protein selectively cleaved these CBASS cyclic dinucleotides and trinucleotides. A deletion mutant of T4 (Δacb1) failed to degrade 3′3′-cGAMP and showed over 300-fold reduced replication in CBASS-expressing E. coli compared to wild-type T4 (ECO_0001038). The crystal structure of Acb1 bound to 3′3′-cGAMP (ECO_0001034) revealed the mechanism of substrate recognition and metal-independent hydrolysis. In vitro, Acb1-treated 3′3′-cGAMP failed to activate CBASS effector proteins such as Cap5, confirming functional inhibition of immune signaling.
MoA Category degrades or sequesters molecules utilised by host defence systems
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli KTE188 type III CBASS
Relevant publication(s) DOI 10.1038/s41586-022-04716-y
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 7T26
Genome(s) encoding the protein Protein Source Escherichia phage T4
Defence system(s) inhibited by the protein Defences CBASS

3D structure

PDB entry model.

A similar PDB structure exists: 7T26

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
Acb1 PF23474 144 1 144 9 150 9 150 2.9e-62

Sequence Viewer

Amino acid position: -

MMEFKDFSTGLYVAAKFSELTLDALEELQRSLRVPNPVPREKIHSTICYSRVNVPYVPSSGSFEVASSGHLEVWKTQDGSTLVLVLDSEYLRCRHMYARALGATHDFDDYTPHITLSYNVGPLSFSGDVQIPVVLDREYKEPLKLDWADDLK