Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Acb2

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds and sequesters CBASS signalling molecules (3′,3′-cGAMP, c-di-AMP, 3′,3′-c-di-UMP, 3′,3′-cUA and 3′,3′-cUG). Triggers the Panoptes defence system (DOI: 10.1038/s41586-025-09557-z) by binding 2′,3′-c-di-AMP, a signalling molecule synthesised by the defence system to keep it inactive.
Evidence Genetic deletion of acb2 (deletion mutation phenotypic evidence, ECO_0001038) from the phage genome results in a loss of viral infectivity. Acb2 binding to the signaling molecules is supported by isothermal titration calorimetry evidence (ECO_0001825) and X-ray crystallography evidence (ECO_0005670).
MoA Category degrades or sequesters molecules utilised by host defence systems
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Pseudomonas aeruginosa type II CBASS system
Relevant publication(s) DOI 10.1016/j.cell.2022.12.041
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 8H2X_A
Genome(s) encoding the protein Protein Source Pseudomonas phage PaMx33
Defence system(s) inhibited by the protein Defences CBASS

3D structure

PDB entry model.

A similar PDB structure exists: 8H2X_A

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
Acb2_Tad1_hairpin PF24729 58 1 58 10 104 10 104 3.7e-18

Sequence Viewer

Amino acid position: -

MDNQHRKIAGYRELTQDDIDLMNRVKAVGAELLALQAALAGRLSTDLEVKQAAAKASKLAPEHESSPECVELRRFLAAEPLRWAAIAKTDIQTGVMALVRAIAQPEGC