Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Acb3

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds to the bacterial CD-NTase enzyme, which is involved in the synthesis of cyclic nucleotides in the CBASS response; also inhibits the human cGAS protein, a key component of the innate immune response to viral infections.
Evidence Ectopic expression (ECO_0000017) of acb3 in E. coli inhibits CBASS-mediated antiphage defense in a plaque formation assay.
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype E. coli KTE188 type III CBASS
Relevant publication(s) DOI 10.1016/j.cell.2024.12.035
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Ga0194137_1000084820 (IMG/VR)
Defence system(s) inhibited by the protein Defences CBASS

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MKEVYKHEFNYWQQLIAMLTTMWRINKDSIDFKWGYFAPRFGLELRLNRGGYFDPYYAIAFCFIWGKFHIKLPFKTSLGEGCDLPKYGFTVSSNTLMLYWGGKFDNSIGQTNSRLKCWDLPFISYVFEHHKVLNKQGTWEDGTASYDNQNINRESYPYTYVLKSGEIQQRTATCFVEERQWHRKWLPWVKLVKPTISIEFSSEVGERVGSWKGGVTGCGYDLLPDETIEECLKRMELTRKFT