Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Acb4

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) sequesters the CBASS signalling molecule 3′3′-cGAMP.
Evidence Acb4 was identified as an anti-CBASS sponge protein through a biochemical screen using phage-infected lysates tested for binding to the CBASS signal 3′3′-cGAMP. EMSA assays revealed that SPO1-infected lysates shifted radiolabeled 3′3′-cGAMP, indicating strong signal sequestration (ECO_0001807). Activity-guided fractionation and mass spectrometry (ECO_0001096) pinpointed SPO1 gp1.3 (Acb4) as the binding protein. In vitro, Acb4 suppressed Cap5 nuclease activation by sequestering 3′3′-cGAMP, blocking downstream DNA degradation. In vivo, engineered phage T4 Δacb1/Δacb2::acb4 replicated efficiently in E. coli expressing Yersinia CBASS (signaling via 3′3′-cUA), rescuing ~10⁴-fold loss in fitness seen in Acb1/Acb2-deficient T4. EMSA with infected lysates confirmed functional expression of Acb4 during infection. Acb4 failed to counteract Citrobacter CBASS (3′2′-cGAMP signaling), suggesting specificity. A 2.1 Å co-crystal structure showed Acb4 forms a tetramer that selectively binds CBASS signals with high affinity (~157 nM K_D) via nucleobase-specific binding pockets. Mutagenesis of key contact residues impaired binding, confirming their role in CBASS inhibition.
MoA Category degrades or sequesters molecules utilised by host defence systems
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Yersinia aleksiciae type I CBASS and Citrobacter portucalensis/Escherichia coli type II CBASS
Relevant publication(s) DOI 10.1101/2024.12.30.630793
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 9E4W
Genome(s) encoding the protein Protein Source Bacillus phage SPO1
Defence system(s) inhibited by the protein Defences CBASS

3D structure

PDB entry model.

A similar PDB structure exists: 9E4W

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
Phage_gp49_66 PF13876 82 21 70 30 79 11 88 1.6e-10

Sequence Viewer

Amino acid position: -

MKINAENFECLRESKLKRKVYEDLVKEATFVRVSPKSTVCVVTDHNSFEVIGTSSVYKVENFNDEIGRDTALSQALDSFIKFLAYSGELSDVLENI