Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Acb5a

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) cleave and inactivate 3′3′-cGAMP and related molecules
Evidence Acb5 was identified as an anti-CBASS enzyme through growth and plaque assays showing that co-expression of Acb5 with a CBASS system from E. albertii restored infectivity of phages T2 and Bas60. In phage-infected cells expressing the CD-NTase enzyme, co-expression of Acb5 led to complete loss of detectable 3′3′-cGAMP, measured by ELISA (ECO_0000267). Thin-layer chromatography (ECO_0000140) and HPLC ( ECO_0001272) analyses demonstrated enzymatic cleavage of 3′3′-cGAMP by Acb5 into 2′3′-cAMP and 2′3′-cGMP, with similar partial activity against 3′3′-cUA. AlphaFold3 models predicted conserved interfacial binding pockets for both substrate and cleavage products, stabilized by conserved residues (e.g., R10, H61, W38), whose alanine mutations abolished anti-defense function.
MoA Category degrades or sequesters molecules utilised by host defence systems
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia albertii MOD1-EC1698 type I CBASS
Relevant publication(s) DOI 10.1101/2025.07.12.664507
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Metagenomics data (IMG_VR ID: IMGVR_UViG_3300024284_000007)
Defence system(s) inhibited by the protein Defences CBASS

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MRRFKVYRPNPPEGYLESGTANPPEEVQFEGVVFSDGTVCVRWLTEFRSHSLWSSLADLVKVHGHSEYGTLWEWLDE