Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIB2

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) hypothesised to act as a DNA mimic, with some tentative evidence that it binds Cas3.
Evidence AcrIB2 was identified as an inhibitor of the type I-B CRISPR-Cas system through conjugation assays in Clostridioides difficile. A plasmid containing a protospacer targeted by the CRISPR system failed to establish in recipient cells unless AcrIB2 was expressed, indicating interference inhibition. In a self-targeting assay, induction of a CRISPR array targeting the chromosomal hfq gene was lethal unless AcrIB2 was co-expressed, resulting in restored cell viability and growth. Genomic sequencing after CRISPR induction showed loss of DNA coverage near the target site in the absence of AcrIB2, while co-expression of AcrIB2 preserved genomic integrity, confirming interference suppression. Deletion analysis of CRISPR-Cas operons demonstrated that only the partial cas operon is responsible for interference and is the target of AcrIB2. Expression of AcrIB2 in a strain lysogenized with φCD38-2 partially suppressed CRISPR-mediated toxicity, indicating its activity in a prophage context. Mass spectrometry following co-purification with tagged AcrIB2 revealed enrichment of Cas3, suggesting a direct interaction. Structural predictions and conserved sequence features supported a DNA mimicry mechanism of action.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Clostridioides difficile type I-B CRISPR-Cas
Relevant publication(s) DOI 10.1128/msphere.00401-23
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Clostridium difficile phage φCD38-2
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MNKQKARRFLRVIDMNIDKIEEEAIKAFKESCLIKETNNIKIYIDIQGKVEAIAVQTWAKLLGDDKEINIFTLNQAPTHLNDMLGEICYVNDYEEFENWCENEWENLDWDSYKKFNKENFEEIAERNIDDSTSVFLEELQKGIESCKQELQNVIEN