Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIB3

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) replaces Cas5 (shares sequence similarity to Cas proteins) in a defective Cascade interference complex that fails to engage target DNA.
Evidence Ectopic expression of AcrIB3 in L. seeligeri LS1 (ECO_0001038) blocked Cas3-mediated degradation of a target plasmid. Expression of AcrIB3 blocks CRISPR interference. AcrIB3 co-purified with the Cascade complex (Cas6–3×Flag), indicating it integrates into the complex (ECO_0000085).
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Listeria seeligeri type I-B CRISPR-Cas
Relevant publication(s) DOI 10.1038/s41586-024-07923-x
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source MGE and prophages in Listeria genomes
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
Cas_Cas5d PF09704 217 2 160 4 160 3 194 1.8e-10

Sequence Viewer

Amino acid position: -

MKAIKLNVYLETANFRNPMSFQSKESYPLPPFSTVIGMVHVACGFKSYHAMDVSVAGNSFSTVHDLASRYEFNPTTKYESARHQMKVYSPQKDKMIGITQGISHIHLITDLHLQLHIIPEDQSEVYFIESKLKNPSQFLSLGRHEDVMMIKDVKVIDVQEETLPSNRELTKATYVPVSYKIGGAFFRLNKNYELVEQKKKWYRKFSKQEVLYAGEGTIIPKDSLIWVDEDGEVLFPV