Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIC1

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence DMS3m phage was genetically engineered to carry the acrIC1 gene. This phage was then used to infect PAO1IC, a strain expressing the PaLML1 Type I-C system and a phage-targeting crRNA. The engineered phage produced plaques on PAO1IC at levels comparable to a control strain lacking CRISPR targeting. In CRISPRi assays, it did not relieve transcriptional repression, indicating that Cascade still binds DNA.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Moraxella bovoculi type I-C CRISPR-Cas
Relevant publication(s) DOI 10.1126/science.aau5174, 10.1093/nar/gkab006
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Moraxella bovoculi
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MNNLKKTAITHDGVFAYKNTETVIGSVGRNDIVMAIDATHGEFNDKNFIIYADTNGNPIYLGYAYLDDNNDAHIDLAVGACNEDDDFDEKEIHEMIAEQMELAKRYQELGDTVHGTTRLAFDDDGYMTVRLDQQAYPDYRPENDDKHIMWRALALTATGKELEVFWLVEDYEDEEVNSWDFDIADDWREL