Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIC11

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence AcrIC11 was identified from Xanthomonas albilineans and tested for its ability to inhibit the Type I-C CRISPR-Cas system. In E. coli Cas3 degradation assays, co-expression of Cascade, targeting crRNA, and Cas3 led to cell death due to chromosomal targeting. Co-expression of AcrIC11 restored colony formation, indicating effective inhibition. In vitro TXTL assays confirmed that AcrIC11 inhibited DNA degradation but not DNA binding by Cascade. deGFP repression assays showed no significant impact on Cascade-DNA binding, while degradation assays revealed ~60% inhibition of Cas3 activity. AlphaFold-based structural comparison with KlcA supports functional homology (RMSD = 1.467 Å), consistent with nuclease-targeting activity.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Xanthomonas albilineans CFBP7063 type I-C CRISPR-Cas system
Relevant publication(s) DOI 10.1093/nar/gkad1097
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source MGE in Xanthomonas albilineans
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
Antirestrict PF03230 92 9 92 56 148 52 148 1.2e-14

Sequence Viewer

Amino acid position: -

MNKETQITASAVVGEDKRLEFLSKHFGVRFARRGEALVFAWLLRLAKVPIEWTRLQYYTLSNSGFYLAPRELRISECELSADAVGIVATMLTLRQLAHESAACVEADSTYPAAKLAVTASVKFAQQYHHLAAYSVKHAESINIYRAID