Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIC4

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) interacts with both the Cas7c and Cas8c subunits and inhibits dsDNA binding by acting as a negatively charged structural blockade at the PAM recognition site.
Evidence Phage-encoded acrIC4 was introduced into DMS3m and tested on PAO1IC. The phage regained full infectivity (EOP ≈ 1), indicating strong inhibition of Type I-C immunity. AcrIC4 also relieved transcriptional repression in a CRISPRi assay, confirming it blocks DNA binding by Cascade. AcrIC4 activity was unaffected by Cas3–Cas8 tethering. Cryo-EM structure of the type I-C Cascade bound to AcrIC4 (ECO_0006181) revealed how AcrIC4 inhibits DNA targeting, specifically binding at the PAM recognition site, forming an electrostatic and steric blockade that prevents the Cascade complex from engaging with its DNA target.
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Pseudomonas aeruginosa type I-C CRISPR-Cas system
Relevant publication(s) DOI 10.1093/nar/gkab006, 10.1016/j.molcel.2023.01.024
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 8DFO_M
Genome(s) encoding the protein Protein Source MGE in Pseudomonas aeruginosa
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 8DFO_M

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MDNKITPADEEKIREWLNCEEASVDNDGDVWVAVPMTGHWLSDEQKAKYIEWRGDET