Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIC5

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) AlphaFold 3 predicts a direct interaction between Cas8c (https://www.ncbi.nlm.nih.gov/protein/UEM35121.1) and AcrIC5 (ipTM = 0.92, pTM = 0.85).
Evidence The acrIC5 gene was cloned into DMS3m and tested on both PAO1IC and a P. aeruginosa strain expressing a heterologous Eggerthella lenta Type I-C system. In both hosts, the phage carrying AcrIC5 formed plaques at wild-type levels (EOP ≈ 1). CRISPRi assays confirmed DNA binding was inhibited. This demonstrates AcrIC5 has broad activity across divergent I-C systems, despite only moderate Cas protein sequence identity (~35–55%). Binding it supported by computational structure modeling evidence (ECO_0006368).
MoA Category binds and inhibits host defence system (putative)
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Pseudomonas aeruginosa type I-C CRISPR-Cas system
Relevant publication(s) DOI 10.1093/nar/gkab006
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source MGE in Pseudomonas delhiensis
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
AcrIC5 PF22147 53 1 53 4 57 4 57 4.8e-22

Sequence Viewer

Amino acid position: -

MSKVTLNGQQIDFDAAVNLMDAELREELHSAQEWTNDQEFLDAYVQAHAAKFDGEEFQVA