Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIC7

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence Three homologs of acrIC7 (from P. stutzeri, P. citronellolis, and P. aeruginosa) were expressed from DMS3m and tested on PAO1IC and a Type I-E strain. AcrIC7Pst and AcrIC7Pci blocked both Type I-C and I-E systems (EOP ≈ 1 in both). AcrIC7Pae only blocked I-E, not I-C. CRISPRi confirmed that all three variants that inhibited systems also blocked DNA binding.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Pseudomonas aeruginosa type I-C CRISPR-Cas system
Relevant publication(s) DOI 10.1093/nar/gkab006
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source MGE in Pseudomonas stutzeri
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MATVTKITLNGQNHYNFGSECSEADAEGYREWIAQELAENFPGAEIEINEADSTYSVVVEIDDESYYDEARGLKDDVNVFCIDAWDRCPWDWVS