Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIC9

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) mimics the shape and charge distribution of double-stranded DNA (dsDNA), effectively occupying the site where the PAM interacts with the Cascade.
Evidence Ectopic expression (ECO_0000017) of AcrIC9 in P. aeruginosa strains expressing type I-C CRISPR-Cas system restored plating efficiency of CRISPR-sensitive phages JBD8 and DMS3m.
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Pseudomonas aeruginosa strains LL77 type I-C CRISPR-Cas system
Relevant publication(s) DOI 10.1038/s41467-020-17652-0, /10.1016/j.molcel.2023.12.034
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 8G9T_A
Genome(s) encoding the protein Protein Source Rhodobacter phage RcNL1
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 8G9T_A

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

METKMTSFYKITAYNSQALYFWGTDADVDRYVDWLNRDREINVYAAEAIPEAEWAQYEGRDDVLSGEECGWDDFMSAEA