Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrID1

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds as a dimer to the Cas10d.
Evidence A mutant virus, SIRV2M, with a 4 kb deletion (ECO_0001038) including the acrID1 gene, lost the ability to infect Sulfolobus islandicus LAL14/1, which has active CRISPR–Cas systems. Reintroduction (using homologous recombination) of SIRV3 gp02 (acrID1) alone into SIRV2M restored infectivity, indicating gp02 is necessary and sufficient for overcoming CRISPR immunity. Pull-down assays (ECO_0006249) and gel filtration chromatography (ECO_0001049) demonstrated that AcrID1 binds directly to Cas10d, the large subunit of the I-D effector complex.
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Sulfolobus islandicus LAL14/1 type I-D CRISPR-Cas system
Relevant publication(s) DOI 10.1038/s41564-018-0120-z
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 6EXP
Genome(s) encoding the protein Protein Source Sulfolobus islandicus rudivirus 3 isolate SIRV3
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 6EXP

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
DUF1374 PF07118 92 1 91 2 92 2 93 1.5e-14

Sequence Viewer

Amino acid position: -

MNYKELEKMLDVIFENSEIKEIDLFFDPEVEISKQEFEDLVKNADPLQKVVGDNYITETFEWWEFENQYLEFELDYYVKDEKIFVLEMHFWRKIRKLE