Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIE1

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds as a dimer to Cas3 (blocks DNA cleavage).
Evidence AcrIE1 was identified via plaque assays in Pseudomonas aeruginosa strain SMC4386 expressing individual anti-CRISPR genes from plasmids. Expression (ECO_0000017) of ACR88a-32 from phage JBD88a allowed robust infection by CRISPR-sensitive phage JBD8, which otherwise fails to infect due to targeting by the type I-E CRISPR-Cas system. Transformation efficiency assays in lysogenized strains confirmed loss of CRISPR interference, supporting ACR88a-32’s inhibitory role.
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Pseudomonas aeruginosa SMC4386 type I-E CRISPR-Cas
Relevant publication(s) DOI 10.1128/mBio.00896-14
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 6AS4
Genome(s) encoding the protein Protein Source Pseudomonas phage JBD5
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 6AS4

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MEKKLSDAQVALVAAWRKYPDLRESLEEAASILSLIVFQAETLSDQANELANYIRRQGLEEAEGACRNIDIMRAKWVEVCGEVNQHGIRVYGDAIDRDVD