Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIE2

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence AcrIE2 was functionally validated using a phage knockout strategy. Wild-type phage DMS3m carrying the acrIE2 gene (gene 30) infected strain SMC4386 efficiently, while a mutant version lacking acrIE2 (replaced by a type I-F anti-CRISPR) was unable to form plaques due to CRISPR interference (ECO_0001038). Complementary assays using JBD8 plaque formation in plasmid-expressing strains further demonstrated ACR3-30's ability to inhibit the type I-E system in vivo. Expression of ACR3-30 had no effect on E. coli’s type I-E system or on type I-F systems
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Pseudomonas aeruginosa SMC4386 type I-E CRISPR-Cas
Relevant publication(s) DOI 10.1128/mBio.00896-14
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Pseudomonas phage JBD88a
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MNTYLIDPRKNNDNSGERFTVDAVDITAAAKSAAQQILGEEFEGLVYRETGESNGSGMFQAYHHLHGTNRTETTVGYPFHVMEL