Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIE4

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) AlphaFold 3 predicts high-confidence interactions between CasA (Cas8e, https://www.ncbi.nlm.nih.gov/protein/QZE32573.1) and AcrIE4 (ipTM = 0.92, pTM = 0.89) and Cas6e (https://www.ncbi.nlm.nih.gov/protein/QZE32569.1) and AcrIE4 (ipTM = 0.8, pTM = 0.85).
Evidence AcrIE4 was identified in phage JBD5 and shown to inhibit the type I-E system using both transformation efficiency assays and plaque assays. Expression (ECO_0000017) of ACR5-34 from a plasmid in SMC4386 enabled efficient plaque formation by CRISPR-targeted phage JBD8. Additionally, a homolog of ACR5-34 found in a P. aeruginosa mobile genetic element (non-phage) was also shown to have anti-CRISPR activity in plaque assays, suggesting this gene may contribute to horizontal gene transfer by evading CRISPR immunity. Binding it supported by computational structure modeling evidence (ECO_0006368).
MoA Category binds and inhibits host defence system (putative)
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Pseudomonas aeruginosa SMC4386 type I-E CRISPR-Cas
Relevant publication(s) DOI 10.1128/mBio.00896-14
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Pseudomonas phage D3112
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MSTQYTYEQIAEDFRLWGEYMDPNAEMTEEEFQALSTEEKVAMQVEAFGAEA