Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIE4-IF7

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) its N-terminal domain targets the PAM interaction site of the Cas8e subunit, and the C-terminal domain disables target DNA recognition at the PAM interaction site in the Cas8f subunit.
Evidence AcrIE4-IF7 is a chimeric protein that inhibits both type I-E and I-F CRISPR-Cas systems. Upon ectopic expression in P. aeruginosa (ECO_0000017), it restored replication of phages JBD8 (I-E) and DMS3m (I-F), confirming dual activity.
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Pseudomonas aeruginosa SMC4386 type I-E and I-F CRISPR-Cas
Relevant publication(s) DOI 10.1126/science.aau5174, 10.1093/nar/gkac096
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 7VZM
Genome(s) encoding the protein Protein Source MGE in Pseudomonas aeruginosa SMC4386
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 7VZM

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MSTQYTYQQIAEDFRLWSEYVDTAGEMSKDEFNSLSTEDKVRLQVEAFGEEKSPKFSTKVTTKPDFDGFQFYIEAGRDFDGDAYTEAYGVAVPTNIAARIQAQAAELNAGEWLLVEHEA