Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIE6

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence AcrIE6 was validated via ectopic expression (ECO_0000017) in P. aeruginosa with type I-E CRISPR-Cas targeting phage JBD8. Phage plaque formation indicated that AcrIE6 effectively inhibited CRISPR immunity.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Pseudomonas aeruginosa SMC4386 type I-E CRISPR-Cas
Relevant publication(s) DOI 10.1126/science.aau5174
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source MGE in Pseudomonas aeruginosa SMC4386
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MNNDTEVLEQQIKAFELLADELKDRLPTLEILSPMYTAVMVTYDLIGKQLASRRAELIEILEEQYPGHAADLSIKNLCP