Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIE8

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) AlphaFold 3 predicts a high-confidence interactions between CasB (https://www.ncbi.nlm.nih.gov/protein/QZE32572.1) and AcrIE8 (ipTM = 0.85, pTM = 0.87).
Evidence Ectopic expression (ECO_0000017) of AcrIE8 increased the plating efficiency of phages that are normally targeted by active type I-E CRISPR–Cas systems. Binding it supported by computational structure modeling evidence (ECO_0006368).
MoA Category binds and inhibits host defence system (putative)
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Pseudomonas aeruginosa type I-E CRISPR-Cas
Relevant publication(s) DOI 10.1038/s41467-020-19415-3
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source MGE in Klebsiella pneumoniae
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MTTITINTYDPEARFNMSGEEAKEFFAFVEEQAKVSGFDVYYDSCTYVDEESERFVEKCFQNY