Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIF1

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) directly binds Cas7, sterically occluding target DNA and preventing its hybridisation to the crRNA.
Evidence Phage JBD30 evades type I-F CRISPR-Cas immunity in P. aeruginosa PA14 through expression of AcrIF1 (gene 35). A frameshift mutation in gene 35 abolished infectivity on CRISPR-proficient hosts (ECO_0007269). Complementation with plasmid-expressed AcrIF1 restored phage replication (ECO_0000017).
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Pseudomonas aeruginosa PA14 type I-F CRISPR-Cas
Relevant publication(s) DOI 10.1038/nature11723
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 5uz9_I
Genome(s) encoding the protein Protein Source Pseudomonas phage JBD30
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 5uz9_I

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MKFIKYLSTAHLNYMNIAVYENGSKIKARVENVVNGKSVGARDFDSTEQLESWFYGLPGSGLGRIENAMNEISRRENP