Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIF11

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) ADP-ribosylates N250 of the Cas8f subunit, a residue required to recognise the PAM, within the crRNA-guided surveillance (Csy) complex.
Evidence AcrIF11 was discovered as a widespread type I-F inhibitor. When ectopically expressed in P. aeruginosa strains with type I-F CRISPR targeting DMS3m (ECO_0000017), it allowed phage replication, indicating potent inhibition. Biochemical assays demonstrated that AcrIF11 catalyzes ADP-ribosylation of the Csy complex in the presence of NAD, specifically modifying residue N250 of the Cas8f subunit, a critical site for PAM recognition. This modification abolished the DNA binding ability of the Csy complex, confirmed through electrophoretic mobility shift assays (EMSA, ECO_0001807), mass spectrometry (ECO_0001096), and site-directed mutagenesis (e.g., Cas8f N250A). AcrIF11’s enzymatic activity required the presence of the Cas7.6f subunit for binding, and its NAD-binding and catalytic residues were essential for inhibition, as shown by in vitro cleavage and binding assays using catalytic mutants (ECO_0000015).
MoA Category adds a post-translational modification and deactivates bacterial defence
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Pseudomonas aeruginosa type I-F CRISPR-Cas
Relevant publication(s) DOI 10.1126/science.aau5174, 10.1016/j.molcel.2020.09.015
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 6KYF
Genome(s) encoding the protein Protein Source MGE in Pseudomonas aeruginosa
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 6KYF

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MSMELFHGSYEEISEIRDSGVFGGLFGAHEKETALSHGETLHRIISPLPLTDYALNYEIESAWEVALDVAGGDENVAEAIMAKACESDSNDGWELQRLRGVLAVRLGYTSVEMEDEHGTTWLCLPGCTVEKI