Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIF12

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence AcrIF12 was identified using aca4-associated loci and confirmed via ectopic expression in type I-F CRISPR-active P. aeruginosa (ECO_0000017). Phage plaque assays showed restored replication of DMS3m.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Pseudomonas aeruginosa type I-F CRISPR-Cas
Relevant publication(s) DOI 10.1126/science.aau5174
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source MGE in Pseudomonas aeruginosa
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MAYEKTWHRDYAAESLKRAETSRWTQDANLEWTQLALECAQVVHLARQVGEELGNEKIIGIADTVLSTIEAHSQATYRRPCYKRITTAQTHLLAVTLLERFGSARRVANAVWQLTDDEIDQAKA