Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIF13

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds to the Cas5f-8f tail and Cas7.6f subunits of the Csy complex to block target DNA recognition.
Evidence AcrIF13 from Moraxella catarrhalis was ectopically expressed in P. aeruginosa (ECO_0000017), completely inhibiting type I-F CRISPR-Cas immunity and restoring phage replication. Competitive binding experiments demonstrated that AcrIF13 targets the Cas5f-Cas8f tail of the complex, similarly to AcrIF2, and also requires Cas7.6f for stable binding. Native gel electrophoresis confirmed that AcrIF13 does not bind the Cas5f-8f heterodimer alone, unlike other Acrs, indicating multivalent interactions. Electrophoretic mobility shift assays (EMSA, ECO_0000096) showed that AcrIF13 potently blocked DNA binding to the Csy complex at a 1:1 molar ratio, confirming its role as a DNA mimic. Site-directed mutagenesis of acidic residues on AcrIF13 and basic residues on Cas8f and Cas7f reduced binding affinities by up to 40-fold (e.g., D113K mutant KD = 67.65 nM), further confirming critical electrostatic interactions mediating inhibition.
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Pseudomonas aeruginosa type I-F CRISPR-Cas
Relevant publication(s) DOI 10.1126/science.aau5174, 10.1016/j.jbc.2022.101636
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 7FI4
Genome(s) encoding the protein Protein Source Moraxella phage Mcat5
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 7FI4

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MKLLNIKINEFAVTANTEAGDELYLQLPHTPDSQHSINHEPLDDDDFVKEVQEICDEYFGKGDRTLARLSYAGGQAYDSYTEEDGVYTTNTGDQFVEHSYADYYNVEVYCKADLV