Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIF14

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds to the Cas7.4/7.6f subunits of the Csy complex, inducing strong non-specific DNA binding activity.
Evidence AcrIF14, encoded in phage Mcat5, was validated through ectopic expression in type I-F CRISPR-active strains (ECO_0000017). It restored DMS3m replication, confirming inhibition. Cryo-EM structures of the Csy–AcrIF14 complex (ECO_0006181) showed two AcrIF14 molecules engaging the Cas7.4f and Cas7.6f subunits, sterically blocking crRNA–DNA hybridization. Key interface residues (e.g., R84, Y89, E91, F104, Y105) were identified via mutational analysis; pull-down (ECO_0006249) assays and cleavage assays confirmed their importance for inhibition. Additionally, AcrIF14 induced strong non-sequence-specific dsDNA binding when complexed with Csy, evidenced by electrophoretic mobility shift assays (EMSA, ECO_0000096) using dsDNA (non-specific). This DNA-binding activity was abolished in AcrIF14 mutants targeting its positively charged N-terminal patches, and in Csy complexes bearing mutations in the Cas8f PAM-recognition loop (K247E, N250D) or the R-loop Binding Channel (R207E/R219E/R258E).
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Pseudomonas aeruginosa type I-F CRISPR-Cas
Relevant publication(s) DOI 10.1126/science.aau5174
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 7DU0
Genome(s) encoding the protein Protein Source Moraxella phage Mcat5
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 7DU0

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MKKIEMIEISQNRQNLTAFLHISEIKAINAKLADGVDVDKKSFDEICSIVLEQYQAKQISNKQASEIFETLAKANKSFKIEKFRCSHGYNEIYKYSPDHEAYLFYCKGGQGQLNKLIAENGRFM