Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIF15

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) AlphaFold 3 predicts a direct interaction between Cas8f/Csy1 (AHH51210.1) and AcrIF15 (ipTM = 0.70, pTM = 0.61).
Evidence Ectopic expression (ECO_0000017) of AcrIF15 increased the plating efficiency of phages that are normally targeted by active type I-F CRISPR–Cas systems. Binding it supported by computational structure modeling evidence (ECO_0006368). Prevents CRISPRi, indicating inhibition occurs upstream of DNA binding.
MoA Category binds and inhibits host defence system (putative)
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Pseudomonas aeruginosa type I-F CRISPR-Cas
Relevant publication(s) DOI 10.1038/s41467-020-19415-3
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source MGE in Klebsiella michiganensis
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MTTITIAYEVSNDKVETIKTMVESQQIHNVNFNGEEFTIERGDFTSIDKDEAEHVKLLNKIQDIIHGYS