Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIF18*

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) AlphaFold 3 predicts a direct interaction between Cas8f/Csy1 (AHH51210.1) and AcrIF18* (ipTM = 0.71, pTM = 0.61).
Evidence Ectopic expression (ECO_0000017) of AcrIF18 increased the plating efficiency of phages that are normally targeted by active type I-F CRISPR–Cas systems. Prevents CRISPRi, indicating inhibition occurs upstream of DNA binding. Binding it supported by computational structure modeling evidence (ECO_0006368).
MoA Category binds and inhibits host defence system (putative)
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Pseudomonas aeruginosa type I-F and I-E CRISPR-Cas
Relevant publication(s) DOI 10.1038/s41467-020-19415-3
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source MGE in Serratia marcescens
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MTTIKAAYISKDQNWNDGTTTYWFDVNGETFGVVHGGESWNAKVVDCDGAPSDQYTVDQFNITEDMIAE