Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIF2/C2

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) acts as a dsDNA mimic that blocks target recognition by competing for a critical DNA-binding site on Cas7 and Cas8.
Evidence AcrIF2* was expressed from a DMS3m phage and tested on PAO1IC (Type I-C) and PA14 (Type I-F). The engineered phage formed plaques efficiently on both hosts (EOP ≈ 1), demonstrating dual inhibition of I-C and I-F systems. However, when both CRISPR systems were co-expressed in the host (one targeting, one non-targeting), AcrIF2*-phage infectivity dropped ~100–1000-fold at low MOI, suggesting a competition effect between the two systems for the inhibitor. Structural data and mutagenesis of eight acidic residues (to alanine) showed that AcrIF2* can tolerate major surface changes and still function, but loses robustness under competition. In CRISPRi assays, it fully rescued transcription, confirming it acts by blocking Cascade DNA binding. Its function is consistent with DNA mimicry.
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Pseudomonas aeruginosa type I-F and I-C CRISPR-Cas system
Relevant publication(s) DOI 10.1093/nar/gkab006
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 5uz9_J
Genome(s) encoding the protein Protein Source Pseudomonas aeruginosa phages D3112
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 5uz9_J

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MATKTAQMIAQQHKDTVAACEAAEAIAIAKDQVWDGEGYTKYTFDDNSVLIQSGTTQYAMDADDADSIKGYADWLDDEARSAEASEIERLLESVEEE