Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIF5

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds to the Csy–dsDNA complex, destabilising the helical bundle domain of Cas8f and thus preventing subsequent Cas2/3 recruitment.
Evidence The AcrF5 protein, encoded by gene 33 of phage JBD88a, enables escape from CRISPR interference in type I-F systems. Expression in P. aeruginosa PA14 permitted replication of targeted phages and efficient transformation of CRISPR-targeted plasmids (ECO_0000017).
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Pseudomonas aeruginosa PA14 type I-F CRISPR-Cas
Relevant publication(s) DOI 10.1038/nature11723
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 7F45
Genome(s) encoding the protein Protein Source Pseudomonas phage JBD5
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 7F45

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MSRPTVVTVTETPRNPGSYEVNVERDGKMVVGRARAGSDPGAAAAKAMQMAMEWGSPNYVILGSNKVLAFIPEQLRVKM