Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIF7

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds to the target DNA-binding site of Cas8f.
Evidence Ectopic expression of AcrF7 in Pseudomonas aeruginosa with a type I-F CRISPR-Cas system lead to restoration of phage replication with CRISPR-sensitive phage. AcrIF7 inhibited CRISPR interference. Electrophoretic Mobility Shift Assays (ECO_0000096) shows binding to the Csy complex. Pull-down experiments and gel filtration, indicating specific interaction with Cas8f (ECO_0006249).
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Pseudomonas aeruginosa type I-F CRISPR-Cas
Relevant publication(s) DOI 10.1038/nmicrobiol.2016.85, 10.1093/nar/gkaa690
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 6M3N
Genome(s) encoding the protein Protein Source Pseudomonas phage LPB1
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 6M3N

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

GHMTTFTSIVTTNPDFGGFEFYVEAGQQFDDSAYEEAYGVSVPSAVVEEMNAKAAQLKDGEWLNVSHEA