Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIF9

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds to the effector complex, triggering sequence-non-specific dsDNA binding.
Evidence Ectopic expression (ECO_0000017) of AcrIF9 in Pseudomonas aeruginosa resulted in inhibition of type I-F CRISPR-Cas system activity, as demonstrated by restored replication of CRISPR-targeted bacteriophages in plaque assays.
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Pseudomonas aeruginosa type I-F CRISPR-Cas
Relevant publication(s) DOI 10.1038/nmicrobiol.2016.85
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 7C78
Genome(s) encoding the protein Protein Source MGE in Vibrio parahaemolyticus
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 7C78

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MKAAYIIKEVQNINSEREGTQIEATSLSQAKRIASKEQCFHGTVMRIETVNGLWLAYKEDGKRWVDCQ