Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIIA1

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds Cas9, triggering its degradation during lysogeny.
Evidence Genetic deletions of acrIIA1 (deletion mutation phenotypic evidence, ECO_0001038) in the prophage result in restored CRISPR-Cas9 function, as demonstrated by regained plasmid-targeting ability in Listeria monocytogenes. Conversely, ectopic expression of gene (ECO_0000017) in a CRISPR-active, prophage-cured background inhibits CRISPR-Cas9 activity, restoring transformation/plating efficiency with a targeted plasmid. Binding is supported by x-ray crystallography evidence (ECO_0005670).
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Listeria monocytogenes type II-A and type II-C CRISPR-Cas
Relevant publication(s) DOI 10.1016/j.cell.2016.12.009, 10.1093/nar/gkx1181
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 5Y6A
Genome(s) encoding the protein Protein Source Listeria monocytogenes prophage 10403S
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 5Y6A

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
HTH_26 PF13443 63 2 57 6 61 5 66 5.2e-07

Sequence Viewer

Amino acid position: -

MTIKLLDEFLKKHDLTRYQLSKLTGISQNTLKDQNEKPLNKYTVSILRSLSLISGLSVSDVLFELEDIEKNSDDLAGFKHLLDKYKLSFPAQEFELYCLIKEFESANIEVLPFTFNRFENEEHVNIKKDVCKALENAITVLKEKKNELL