Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIIA10

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binding affinity to SpCas9 was demonstrated using biolayer interferometry, but detailed MoA is unknown.
Evidence A synthetic E. coli strain was engineered with a genetic circuit where SpCas9 targeted a plasmid-borne chloramphenicol resistance gene. If an anti-CRISPR protein inhibits Cas9, the strain retains chloramphenicol resistance and survives antibiotic selection (ECO_0007003). In vitro cleavage assay evidence (a biochemical assay where purified Cas9 protein and guide RNA are incubated with target DNA and a candidate ACR protein outside of any living cell) further supported anti-CRISPR activity. Direct binding is supported by biolayer Interferometry evidence (ECO_0006350).
MoA Category binds and inhibits host defence system (putative)
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Streptococcus pyogenes type II-A CRISPR-Cas
Relevant publication(s) DOI 10.1016/j.chom.2019.01.003
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Metagenome
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MDNKFKLRKAINGIEELNFAFDKLTAIDYKTICRIERKMNGLSVDALADSIIASAGTRKTSSEFRIACAWVAAVKGTDGLTVDDYDQLSLDDLLELETFGLLFFVGSLE