Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIIA11

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds SpyCas9 to inhibit dsDNA cleavage.
Evidence AcrIIA11 was identified as a potent anti-CRISPR protein through a two-step functional metagenomic selection that screened for elements protecting a plasmid with a kanamycin resistance gene from cleavage by SpyCas9 in E. coli. A contig derived from a Lachnospiraceae phage conferred the highest level of resistance and was significantly enriched after selection. Targeted mutagenesis of all five ORFs in the contig revealed that orf_3, named acrIIA11, was solely responsible for SpyCas9 inhibition; introducing a stop codon in this ORF eliminated the protective effect. When cloned alone, AcrIIA11 protected plasmids as effectively as known inhibitors such as AcrIIA4. In phage infection assays, AcrIIA11 expression (ECO_0000017) restored infectivity of Mu phage in E. coli expressing a SpyCas9–targeting crRNA, demonstrating functional inactivation of the CRISPR defense. Further support came from in vitro assays: purified AcrIIA11 inhibited SpyCas9-mediated DNA cleavage in a dose-dependent manner, with size exclusion chromatography (ECO_0000325) suggesting that the active form is a dimer. Pull-down assays (ECO_0006249) showed AcrIIA11 binds both apo- and sgRNA-bound forms of SpyCas9, with moderate preference for the latter. Electrophoretic mobility shift assays (ECO_0000096) demonstrated that unlike AcrIIA4, AcrIIA11 does not block SpyCas9–DNA binding but instead forms a supershifted ternary complex, indicating a novel mechanism of inhibition involving both SpyCas9 and dsDNA interaction.
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Streptococcus pyogenes type II-A CRISPR-Cas
Relevant publication(s) DOI 10.7554/eLife.46540
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Metagenome
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MADMTLRQFCERYRKGDFLAKDRETQIEAGWYDWFCDDKALAGRLAKIWGILKGITSDYILDNYRVWFKNNCPMVGPLYDDVRFEPLDEEQRDELYFGVAIDDKRREKKYVIFTARNDYENECGFNNVREVRQFINGWEDELKNEEFYKAREKKRQEMEEANNKFAEIMQRADEILWNLKED