Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIIA13

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) AlphaFold 3 predicts a direct interaction between SauCas9 and AcrIIA13 (ipTM = 0.9, pTM = 0.79), which is supported by a PDB entry without a corresponding publication (https://www.rcsb.org/structure/7ENI).
Evidence AcrIIA13 was cloned into a plasmid and tested in a TXTL assay, where it restored GFP expression otherwise suppressed by SauCas9 (ECO_0000017), confirming inhibition. In vitro cleavage assays showed that AcrIIA13 blocked SauCas9-mediated DNA cleavage, primarily by preventing DNA binding. RNA EMSA confirmed it did not interfere with RNP formation (ECO_0001807). Binding it supported by computational structure modeling evidence (ECO_0006368).
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Staphylococcus aureus type II-A CRISPR-Cas
Relevant publication(s) DOI 10.1073/pnas.1917668117
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 8K4M
Genome(s) encoding the protein Protein Source MGE in Staphylococcus schleiferi
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 8K4M

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MEVMNKSIEIKDQNNIVLIDSLGQFFTDIENDNNGRYNIDYVLLNEVEHDNGNTYYEVGMYRTEEVPFSDKVTQDNVELLEDKWLQIDQQGESYVESIFFENEEDAREYIKLVLKGHETFEETAKAIGVIK