Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIIA14

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence AcrIIA14 was discovered through guilt-by-association analysis using genes co-occurring with an aca-like gene near AcrIIA13. AcrIIA14 was cloned and tested in a TXTL assay, where it restored GFP expression suppressed by SauCas9, indicating anti-CRISPR activity (ECO_0000017). In vitro cleavage assays showed complete inhibition of SauCas9 activity, despite RNA and DNA EMSAs showing no interference with RNP formation or DNA binding (ECO_0001807). This suggests AcrIIA14 blocks cleavage post-DNA binding. Deletion of the N-terminal domain reduced but did not eliminate activity (ECO_0007379).
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Staphylococcus aureus type II-A CRISPR-Cas
Relevant publication(s) DOI 10.1073/pnas.1917668117
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 7ENM
Genome(s) encoding the protein Protein Source MGE in Staphylococcus simulans
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 7ENM

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

SMKSVKYISNMSKQEKGYRVYVNVVNEDTDKGFLFPSVPKEVIENDKIDELFNFEHHKPYVQKAKSRYDKNGIGYKIVQLDEGFQKFIELNKEKMKENLDY