Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIIA19

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence Ectopic expression (ECO_0000017) of AcrIIA19 in a P. aeruginosa strain with a heterologous SpyCas9 CRISPR system restores replication of sensitive phage. AcrIIA16's expression inhibit CRISPR Interference, suggesting inhibiting of SpyCas9 at the step of target DNA binding or at an upstream stage. Co-immunoprecipitation (ECO_0005644) showed binding to Cas9.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Streptococcus pyogenes type II-A CRISPR-Cas
Relevant publication(s) DOI 10.1038/s41564-020-0692-2
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source MGE in Staphylococcus simulans
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MKLIVEVEETNYKNLVNYTKLTNESHNILVNRLISEYITKPYELRLDLSERYSNRDLIEFKFMLIEYCKEALQDIKELANSDEAYETDEAFEAVFRQLFEEVISNPDTVLKAFHSYTSFLEENK