Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIIA2

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) prevents Cas9 binding to DNA by occluding the protein residues required for DNA binding.
Evidence Genetic deletions of acrIIA2 (deletion mutation phenotypic evidence, ECO_0001038) in the prophage result in restored CRISPR-Cas9 function, as demonstrated by regained plasmid-targeting ability in Listeria monocytogenes. Conversely, ectopic expression of gene (ECO_0000017) in a CRISPR-active, prophage-cured background inhibits CRISPR-Cas9 activity, restoring transformation/plating efficiency with a targeted plasmid. Binding is supported by x-ray crystallography evidence (ECO_0005670).
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Listeria monocytogenes type II-A and type II-C
Relevant publication(s) DOI 10.1016/j.cell.2016.12.009, 10.1016/j.molcel.2018.11.011
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 6MCB_C
Genome(s) encoding the protein Protein Source Listeria monocytogenes prophage 10403S
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 6MCB_C

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MTLTRAQKKYAEAMHEFINMVDDFEESTPDFAKEVLHDSDYVVITKNEKYAVALCSLSTDECEYDTNLYLDEKLVDYSTVDVNGVTYYINIVETNDIDDLEIATDEDEMKSGNQEIILKSELK