Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIIA20

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence In vitro DNA cleavage assays with SpyCas9, SinCas9, SauCas9, and AsCas12a showed Strong inhibition of SinCas9, weak inhibition of SpyCas9 and no inhibition of SauCas9 or AsCas12a. Competition binding assay with AcrIIA2 shows ML1 binds Cas9–sgRNA and blocks AcrIIA2 binding.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Streptococcus iniae type II-A CRISPR-Cas
Relevant publication(s) DOI 10.1093/nar/gkaa219
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source MGE in Streptococcus iniae
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MKNYEVTNEVKNLNTQVETIGQAVDLYKEYGSNTIVWSIDKNEDLIDEVTELVAEYAEKGTVIK