Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIIA21

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence In vitro DNA cleavage assays with SpyCas9, SinCas9, SauCas9, and AsCas12a showed strong inhibition of SinCas9, weak inhibition of SpyCas9, SinCas9, and SauCas9 and no inhibition of AsCas12a.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Streptococcus pyogenes, Streptococcus aureus, and Streptococcus iniae type II-A CRISPR-Cas
Relevant publication(s) DOI 10.1093/nar/gkaa219
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source MGE in Streptococcus agalactiae GB00548
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
RepA_N PF06970 76 3 76 7 80 5 80 5e-31

Sequence Viewer

Amino acid position: -

MDYDNENYLIPKILLQDDFYSSLSAKDILVYAVLKDRQIEALEKGWIDTDGSIYLNFKLIELAKMFSCSRTTMIDVMQRLEEVNLIERERVDVFYGYSLPYKTYINEV