Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIIA22

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) modifies MGE DNA topology.
Evidence AcrIIA22 was identified as a novel anti-CRISPR through a functional metagenomic screen using a two-plasmid system in E. coli, where its expression allowed retention of a kanamycin-resistant target plasmid otherwise eliminated by SpyCas9. Deletion (ECO_0001038) or mutation of acrIIA22 (orf_1) abolished this protective effect, confirming its necessity and sufficiency for CRISPR inhibition. AcrIIA22 did not bind or inhibit SpyCas9 in vitro directly, suggesting an alternative mechanism. Structural analysis via X-ray crystallography (PDB: 7JTA) revealed homology to PC4-like nucleic acid–binding proteins, predicting a role in DNA interaction. Biochemical assays demonstrated that AcrIIA22 functions as a DNA nickase, converting supercoiled plasmids into relaxed forms in vivo and in vitro. Mutations that impaired this nicking activity (e.g., D14A or natural variant AcrIIA22a) also reduced anti-CRISPR activity in bacterial plasmid protection assays, confirming that DNA nicking underlies its function. Pre-nicked plasmids became resistant to SpyCas9 cleavage in vitro, linking AcrIIA22’s activity to altered DNA topology and impaired Cas9 R-loop formation.
MoA Category modifies phage molecules to avoid recognition
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Streptococcus pyogenes type II-A CRISPR-Cas
Relevant publication(s) DOI 10.1371/journal.pbio.3001428
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 7JTA_A
Genome(s) encoding the protein Protein Source Metagenome
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 7JTA_A

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MVVEETRDLAETADCVVIEAILVDDGLRYRQLSVGIKDENGDIIRIVPISTVLI