Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIIA24

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence Ectopic expression of AcrIIA24 conferred resistance to CRISPR targeting in E. coli expressing St3Cas9 (ECO_0000017). AcrIIA24 was cloned into a plasmid and co-expressed with St3Cas9 and a targeting sgRNA. In plasmid interference assays, AcrIIA24 significantly restored bacterial colony formation. In vitro cleavage assays showed that AcrIIA24 did not prevent DNA binding by Cas9 but strongly inhibited cleavage.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Streptococcus thermophilus and Streptococcus pyogenes type II-A CRISPR-Cas
Relevant publication(s) DOI 10.1093/nar/gkac099
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Streptococcus phage CHPC930
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MKKAQQLLKEIKTNNVSYAIMDEDNEIYCNKETNNIMDIYGYDNENGHFYGVYGDVVDGQIDSRYFSDDAILNAIDKLLFLGDPIKRTDLPSDADFKRTFFFEE