Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIIA28

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds to the REC3 domain of SpyCas9.
Evidence AcrIIA28 was identified from a Streptococcus phage element and tested using a plasmid interference assay in E. coli. In this system, E. coli was engineered to express SpyCas9 or St3Cas9 and an sgRNA targeting a co-transformed plasmid carrying an antibiotic resistance gene. Cas9-mediated cleavage of this plasmid resulted in loss of resistance and prevented colony formation on selective media. Co-expression of AcrIIA28 reversed this Cas9-induced growth inhibition, indicating strong anti-CRISPR activity. In vitro DNA cleavage assays confirmed that AcrIIA28 prevented formation of the Cas9–DNA complex. EMSAs further demonstrated that AcrIIA28 blocks DNA binding by Cas9 (ECO_0001807), consistent with its function as a DNA binding inhibitor.
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Streptococcus thermophilus and Streptococcus pyogenes type II-A CRISPR-Cas
Relevant publication(s) DOI 10.1093/nar/gkac099
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 8WRX
Genome(s) encoding the protein Protein Source Streptococcus phage Javan128
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 8WRX

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MKTIFTKKQTEELLNDISIEKQKELFNSMHDFRSQHAKEARIPGWSDKYNKLEKKMLSDFEEVTGIKYDTLESELIWDNLSNKFLYNS