Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIIA30

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence AcrIIA30 was identified in a Streptococcus genomic element and shown to be a specific inhibitor of St1Cas9. In the plasmid interference assay, E. coli cells expressing St1Cas9 and a plasmid-targeting sgRNA lost the targeted plasmid and failed to grow on selective media. Co-expression of AcrIIA30 restored growth, indicating effective inhibition. In vitro cleavage assays confirmed that AcrIIA30 blocked Cas9–DNA complex formation. EMSA showed that AcrIIA30 not only prevented DNA binding but also caused a supershift (ECO_0001807), suggesting potential dimerization or complex stabilization.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Streptococcus thermophilus type II-A CRISPR-Cas
Relevant publication(s) DOI 10.1093/nar/gkac099
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source MGE in Streptococcus gordonii NCTC7870
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MITANEIVKTHKGIRLVQRKNESWEEFKERIQEVIAKQGDNYLTQTKPVHEIKNKGTRNIRRTYVNILLKEGA