Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIIA33

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence AcrIIA33 was discovered from Streptococcus DNA and tested using a system in E. coli designed to identify anti-CRISPR proteins. In this system, Cas9 cuts a plasmid that carries a red fluorescent gene called mCherry. Cutting this plasmid kills the bacteria because the plasmid is needed for survival. When AcrIIA33 was expressed, bacteria survived, meaning Cas9 was blocked. This showed that AcrIIA33 stops Cas9 from cutting DNA.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Streptococcus pyogenes type II-A CRISPR-Cas
Relevant publication(s) DOI 10.1093/nar/gkad995
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source MGE in Streptococcus equi DSM 20561
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MELNFVGQFDNGHDFYDVEKFVDVNVETGRLSDEDIIKVYDALRNEHRLRRGKGKYGNLLSFAEYGDEDVLTDTTYWYEEDILPAQDRLEEL