Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIIA34

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence In E. coli, co-expression of AcrIIA34 with Cas9 allowed bacteria to grow, showing it blocked Cas9 from cutting the plasmid. Lab tests confirmed it does not block sgRNA loading, but does block Cas9 from binding DNA, as shown by DNA binding (EMSA) experiments (ECO_0001807).
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Streptococcus pyogenes type II-A CRISPR-Cas
Relevant publication(s) DOI 10.1093/nar/gkad995
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source MGE in Streptococcus lutetiensis AM38-2
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MKNIANEIKTIRYAFEDGRSTQKSIMRKIKALTDQFETMDDLIDSLNSYADTHYTWAITYFQLARIIISFQASNNTTSEKKIDLQSGPIEVNGKLKIRVTVDEFMADLANWEHLEDIKKLAKELA