Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIIA5

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds Cas9, inhibiting its activity.
Evidence Ectopic expression (ECO_0000017) of AcrIIA5 increased the plating efficiency of phage D5842 that is normally targeted by active type II-A CRISPR–Cas systems. Binding to Cas9-DNA complex is supported by Electrophoretic Mobility Shift Assays (ECO_0000096).
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Streptococcus thermophilus type II-A CRISPR-Cas
Relevant publication(s) DOI 10.1038/s41564-017-0004-7, 10.1016/j.celrep.2019.10.078
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 6LKF
Genome(s) encoding the protein Protein Source Streptococcus phage D4276
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 6LKF

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MAYGKSRYNSYRKRSFNRSNKQRREYAQEMDRLEKAFENLDGWYLSSMKDSAYKDFGKYEIRLSNHSADNKYHDLENGRLIVNIKASKLNFVDIIENKLDKIIEKIDKLDLDKYRFINATNLEHDIKCYYKGFKTKKEVI