Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: AcrIIA6

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds allosteric centre of the Cas9 protein inducing its dimerisation and reducing its DNA binding affinity
Evidence Ectopic expression (ECO_0000017) of AcrIIA6 from a plasmid in Streptococcus thermophilus with a type II-A CRISPR-Cas system completely abolished immunity against the CRISPR-sensitive virulent phage D5842.
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Lactococcus lactis type II-A CRISPR-Cas
Relevant publication(s) DOI 10.1038/s41467-018-05092-w
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 6EYX
Genome(s) encoding the protein Protein Source Streptococcus phage D4276
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

PDB entry model.

A similar PDB structure exists: 6EYX

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MKINDDIKELILEYMSRYFKFENDFYKLPGIKFTDANWQKFKNGGTDIEKMGAARVNAMLDCLFDDFELAMIGKAQTNYYNDNSLKMNMPFYTYYDMFKKQQLLKWLKNNRDDVIGGTGRMYTASGNYIANAYLEVALESSSLGSGSYMLQMRFKDYSKGQEPIPSGRQNRLEWIENNLENIR